PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID orange1.1g007284m
Common NameCISIN_1g007284mg
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; malvids; Sapindales; Rutaceae; Aurantioideae; Citrus
Family GRAS
Protein Properties Length: 610aa    MW: 67336.9 Da    PI: 6.3282
Description GRAS family protein
Gene Model
Gene Model ID Type Source Coding Sequence
orange1.1g007284mgenomeICGCView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1GRAS267.44.8e-822146082374
               GRAS   2 velLlecAeavssgdlelaqalLarlselaspdgd.........pmqRlaayfteALaarlarsvselykalppsetseknsseelaalklf 84 
                        +e L+++Ae+++s++l+ aq +Larl++ ++  g+         p+qR+a +f+eAL++ l++  ++l +  +  ++s+ + ++++ a+k+f
  orange1.1g007284m 214 IEELIRAAECLDSNELQVAQMILARLNHSQNLVGSppvvvaagkPLQRAAIFFKEALSSLLLSLLNGLTRPTSHLSSSWPEIIQSVRAYKAF 305
                        679*************************9776665566666666***************************9999999999*********** PP

               GRAS  85 sevsPilkfshltaNqaIleavege......ervHiiDfdisqGlQWpaLlqaLasRp......egppslRiTgvgspesgskeeleetger 164
                          +sPi+ f+h+++ qa+le++  +        +H+iDfdi+ G+Q++++++++a+++      + + slRiT+v++   +  +e++ ++ +
  orange1.1g007284m 306 TAISPIPMFTHFITTQALLESLFLDrgsgspPLIHVIDFDIGFGGQYASFMREIADKAaaarhsNYSTSLRITAVVP--DDYVTETRLVKAN 395
                        ********************98544344667899*********************9996655544588*********..45999******** PP

               GRAS 165 LakfAeelgvpfefnvlvakrledleleeLrvkpgEalaVnlvlqlhrlld.esvsleserdevLklvkslsPkvvvvveqe..adhnse.. 251
                        L +fA+el++ ++ +++ a+++e+l++++ ++  gE+laV l+  ++r l  +s++ + +  +++  ++++sP+vvv++++e   d +s+  
  orange1.1g007284m 396 LVQFARELRIGLHVDFVPARSFEMLSFKAVKLMDGEKLAVVLSPTVFRRLGgNSTDNAAAVAAFVTDIRRISPNVVVFTDNEawGDFGSGtt 487
                        ****************9999********************9999988877514445555899********************5534455567 PP

               GRAS 252 ...sFlerflealeyysalfdsleaklpres..eerikvErellgreivnvvacegaerrerhetlekWrerleeaGFkpvplsekaakqak 338
                           sF + f+ +leyy+++f+sl+a +++ +  ++++k+E +ll+++i+ +v  +g++       ++ Wre ++ aG++pv+ls++a   a+
  orange1.1g007284m 488 apfSFRRNFVTSLEYYTMVFESLDAAAAAMNagDWARKIETHLLRPKIMAAVEVAGRR-------VAPWREVFSGAGMRPVQLSQFADFLAE 572
                        7889*******************88877777799**********************98.......89************************* PP

               GRAS 339 lllrkvksdgyrveeesgslvlgWkdrpLvsvSaWr 374
                        +ll+kv++ g++v +++++lvl+W++ +Lv++SaWr
  orange1.1g007284m 573 CLLAKVQVGGFHVAKRQAELVLCWHHWALVATSAWR 608
                        ***********************************8 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PROSITE profilePS5098533.481187588IPR005202Transcription factor GRAS
PfamPF035141.7E-79214608IPR005202Transcription factor GRAS
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0006355Biological Processregulation of transcription, DNA-templated
GO:0030154Biological Processcell differentiation
GO:0048831Biological Processregulation of shoot system development
Sequence ? help Back to Top
Protein Sequence    Length: 610 aa     Download sequence    Send to blast
MRVPLKSQQN SQSQQSPERV SSPNNNNINI INSVNVIARS IGGVSNNNNN NIHSRRPNTT  60
NNINITSPVN SGSKCYEPTS VLELRRSPSP IPEWDRDEHM LRTMDWESFI KDLGGLDDDC  120
SSDVAAPQLQ IQHLHPISTD DDSIDHQQQS DFNFNFSSNF NVPAADDVVS LSSSTTQYHN  180
NFPDHHPDAV SNNDNNMIVV NNLGGGFEFD YNYIEELIRA AECLDSNELQ VAQMILARLN  240
HSQNLVGSPP VVVAAGKPLQ RAAIFFKEAL SSLLLSLLNG LTRPTSHLSS SWPEIIQSVR  300
AYKAFTAISP IPMFTHFITT QALLESLFLD RGSGSPPLIH VIDFDIGFGG QYASFMREIA  360
DKAAAARHSN YSTSLRITAV VPDDYVTETR LVKANLVQFA RELRIGLHVD FVPARSFEML  420
SFKAVKLMDG EKLAVVLSPT VFRRLGGNST DNAAAVAAFV TDIRRISPNV VVFTDNEAWG  480
DFGSGTTAPF SFRRNFVTSL EYYTMVFESL DAAAAAMNAG DWARKIETHL LRPKIMAAVE  540
VAGRRVAPWR EVFSGAGMRP VQLSQFADFL AECLLAKVQV GGFHVAKRQA ELVLCWHHWA  600
LVATSAWRC*
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
5hyz_A6e-1325560836375GRAS family transcription factor containing p
Search in ModeBase
Expression -- UniGene ? help Back to Top
UniGene ID E-value Expressed in
Csi.19230.0fruit
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_006428037.10.0hypothetical protein CICLE_v10025197mg
RefseqXP_006493843.10.0PREDICTED: scarecrow-like protein 15
TrEMBLA0A067F8W60.0A0A067F8W6_CITSI; Uncharacterized protein
STRINGPOPTR_0005s12730.11e-167(Populus trichocarpa)
STRINGPOPTR_0007s12480.11e-167(Populus trichocarpa)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
MalvidsOGEM42912857
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT4G36710.11e-126GRAS family protein